Bio::EnsEMBL
BaseAlignFeature
Toolbar
Summary
Bio::EnsEMBL::BaseAlignFeature - Baseclass providing a common abstract
implmentation for alignment features
Package variables
Privates (from "my" definitions)
$message_only_once = 1
Included modules
Inherit
Synopsis
my $feat = new Bio::EnsEMBL::DnaPepAlignFeature(
-slice => $slice,
-start => 100,
-end => 120,
-strand => 1,
-hseqname => 'SP:RF1231',
-hstart => 200,
-hend => 220,
-analysis => $analysis,
-cigar_string => '10M3D5M2I'
);
Alternatively if you have an array of ungapped features
my $feat =
new Bio::EnsEMBL::DnaPepAlignFeature( -features => \@features );
Where @features is an array of Bio::EnsEMBL::FeaturePair
There is a method to manipulate the cigar_string into ungapped features
my @ungapped_features = $feat->ungapped_features();
This converts the cigar string into an array of Bio::EnsEMBL::FeaturePair
$analysis is a Bio::EnsEMBL::Analysis object
Bio::EnsEMBL::Feature methods can be used
Bio::EnsEMBL::FeaturePair methods can be used
The cigar_string contains the ungapped pieces that make up the gapped
alignment
It looks like: n Matches [ x Deletes or Inserts m Matches ]*
but a bit more condensed like "23M4I12M2D1M"
and evenmore condensed as you can ommit 1s "23M4I12M2DM"
To make things clearer this is how a blast HSP would be parsed
>AK014066
Length = 146
Minus Strand HSPs:
Score = 76 (26.8 bits), Expect = 1.4, P = 0.74
Identities = 20/71 (28%), Positives = 29/71 (40%), Frame = -1
Query: 479 GLQAPPPTPQGCRLIPPPPLGLQAPLPTLRAVGSSHHHP*GRQGSSLSSFRSSLASKASA 300
G APPP PQG R P P G + P L + + ++ R +A +
Sbjct: 7 GALAPPPAPQG-RWAFPRPTG-KRPATPLHGTARQDRQVRRSEAAKVTGCRGRVAPHVAP 64
Query: 299 SSPHNPSPLPS 267
H P+P P+
Sbjct: 65 PLTHTPTPTPT 75
The alignment goes from 267 to 479 in sequence 1 and 7 to 75 in sequence 2
and the strand is -1.
The alignment is made up of the following ungapped pieces :
sequence 1 start 447 , sequence 2 start 7 , match length 33 , strand -1
sequence 1 start 417 , sequence 2 start 18 , match length 27 , strand -1
sequence 1 start 267 , sequence 2 start 27 , match length 137 , strand -1
These ungapped pieces are made up into the following string (called a cigar
string) "33M3I27M3I137M" with start 267 end 479 strand -1 hstart 7 hend 75
hstrand 1 and feature type would be DnaPepAlignFeature
Description
No description!
Methods
Methods description
Args : none Example : none Description: abstract method, overwrite with something that returns one or three Returntype : int 1,3 Exceptions : none Caller : internal Status : Stable |
Args : none Example : none Description: PRIVATE (internal) method - creates ungapped features from internally stored cigar line Returntype : list of Bio::EnsEMBL::FeaturePair Exceptions : none Caller : ungapped_features Status : Stable |
Arg 1 : listref Bio::EnsEMBL::FeaturePair $ungapped_features Example : none Description: creates internal cigarstring and start,end hstart,hend entries. Returntype : none, fills in values of self Exceptions : argument list undergoes many sanity checks - throws under many invalid conditions Caller : new Status : Stable |
Args : none Example : none Description: abstract method, overwrite with something that returns one or three Returntype : int 1,3 Exceptions : none Caller : internal Status : Stable |
Arg [1] : None Example : Description: return the alignment length (including indels) based on the cigar_string Returntype : int Exceptions : Caller : Status : Stable |
Arg [1] : string $cigar_string Example : ( "12MI3M" ) Description: get/set for attribute cigar_string cigar_string describes the alignment. "xM" stands for x matches (mismatches), "xI" for inserts into query sequence (thats the ensembl sequence), "xD" for deletions (inserts in the subject). an "x" that is 1 can be omitted. Returntype : string Exceptions : none Caller : general Status : Stable |
Arg [..] : List of named arguments. (-cigar_string , -features) defined in this constructor, others defined in FeaturePair and SeqFeature superclasses. Either cigar_string or a list of ungapped features should be provided - not both. Example : $baf = new BaseAlignFeatureSubclass(-cigar_string => '3M3I12M'); Description: Creates a new BaseAlignFeature using either a cigarstring or a list of ungapped features. BaseAlignFeature is an abstract baseclass and should not actually be instantiated - rather its subclasses should be. Returntype : Bio::EnsEMBL::BaseAlignFeature Exceptions : thrown if both feature and cigar string args are provided thrown if neither feature nor cigar string args are provided Caller : general Status : Stable |
Arg [1] : hashref $hashref A hashref which will be blessed into a PepDnaAlignFeature. Example : none Description: This allows for very fast object creation when a large number of PepDnaAlignFeatures needs to be created. This is a bit of a hack but necessary when thousands of features need to be generated within a couple of seconds for web display. It is not recommended that this method be called unless you know what you are doing. It requires knowledge of the internals of this class and its superclasses. Returntype : Bio::EnsEMBL::BaseAlignFeature Exceptions : none Caller : none currently Status : Stable |
Args : none Example : none Description: reverse complement the FeaturePair, modifing strand, hstrand and cigar_string in consequence Returntype : none Exceptions : none Caller : general Status : Stable |
Arg [1] : int $strands_reversed Example : none Description: get/set for attribute strands_reversed 0 means that strand and hstrand are the original strands obtained from the alignment program used 1 means that strand and hstrand have been flipped as compared to the original result provided by the alignment program used. You may want to use the reverse_complement method to restore the original strandness. Returntype : int Exceptions : none Caller : general Status : Stable |
Arg 1 : String $coordinate_system_name Arg [2] : String $coordinate_system_version Example : $feature = $feature->transform('contig'); $feature = $feature->transform('chromosome', 'NCBI33'); Description: Moves this AlignFeature to the given coordinate system. If the feature cannot be transformed to the destination coordinate system undef is returned instead. Returntype : Bio::EnsEMBL::BaseAlignFeature; Exceptions : wrong parameters Caller : general Status : Medium Risk : deprecation needs to be removed at some time |
Args : none Example : @ungapped_features = $align_feature->get_feature Description: converts the internal cigar_string into an array of ungapped feature pairs Returntype : list of Bio::EnsEMBL::FeaturePair Exceptions : cigar_string not set internally Caller : general Status : Stable |
Methods code
sub _hit_unit
{ my $self = shift;
throw( "Abstract method call!" ); } |
sub _parse_cigar
{ my ( $self ) = @_;
my $query_unit = $self->_query_unit();
my $hit_unit = $self->_hit_unit();
my $string = $self->{'cigar_string'};
throw("No cigar string defined in object") if(!defined($string));
my @pieces = ( $string =~ /(\d*[MDI])/g );
my @features;
my $strand1 = $self->{'strand'} || 1;
my $strand2 = $self->{'hstrand'}|| 1;
my ( $start1, $start2 );
if( $strand1 == 1 ) {
$start1 = $self->{'start'};
} else {
$start1 = $self->{'end'};
}
if( $strand2 == 1 ) {
$start2 = $self->{'hstart'};
} else {
$start2 = $self->{'hend'};
}
foreach my $piece (@pieces) {
my ($length) = ( $piece =~ /^(\d*)/ );
if( $length eq "" ) { $length = 1 }
my $mapped_length;
if( $query_unit == 1 && $hit_unit == 3 ) {
$mapped_length = $length*3;
} elsif( $query_unit == 3 && $hit_unit == 1 ) {
$mapped_length = $length / 3; } elsif ( $query_unit == 1 && $hit_unit == 1 ) {
$mapped_length = $length;
} else {
throw("Internal error $query_unit $hit_unit, currently only " .
"allowing 1 or 3 ");
}
if( int($mapped_length) != $mapped_length and
($piece =~ /M$/ or $piece =~ /D$/)) {
throw("Internal error with mismapped length of hit, query " .
"$query_unit, hit $hit_unit, length $length");
}
if( $piece =~ /M$/ ) {
my ( $qstart, $qend);
if( $strand1 == 1 ) {
$qstart = $start1;
$qend = $start1 + $length - 1;
$start1 = $qend + 1;
} else {
$qend = $start1;
$qstart = $start1 - $length + 1;
$start1 = $qstart - 1;
}
my ($hstart, $hend);
if( $strand2 == 1 ) {
$hstart = $start2;
$hend = $start2 + $mapped_length - 1;
$start2 = $hend + 1;
} else {
$hend = $start2;
$hstart = $start2 - $mapped_length + 1;
$start2 = $hstart - 1;
}
push @features, Bio::EnsEMBL::FeaturePair->new
(-SLICE => $self->{'slice'},
-SEQNAME => $self->{'seqname'},
-START => $qstart,
-END => $qend,
-STRAND => $strand1,
-HSLICE => $self->{'hslice'},
-HSEQNAME => $self->{'hseqname'},
-HSTART => $hstart,
-HEND => $hend,
-HSTRAND => $strand2,
-SCORE => $self->{'score'},
-PERCENT_ID => $self->{'percent_id'},
-ANALYSIS => $self->{'analysis'},
-P_VALUE => $self->{'p_value'},
-EXTERNAL_DB_ID => $self->{'external_db_id'},
-HCOVERAGE => $self->{'hcoverage'},
-GROUP_ID => $self->{'group_id'},
-LEVEL_ID => $self->{'level_id'});
} elsif( $piece =~ /I$/ ) {
if( $strand1 == 1 ) {
$start1 += $length;
} else {
$start1 -= $length;
}
} elsif( $piece =~ /D$/ ) {
if( $strand2 == 1 ) {
$start2 += $mapped_length;
} else {
$start2 -= $mapped_length;
}
} else {
throw( "Illegal cigar line $string!" );
}
}
return\@ features;} |
sub _parse_features
{ my ($self,$features ) = @_;
my $query_unit = $self->_query_unit();
my $hit_unit = $self->_hit_unit();
if (ref($features) ne "ARRAY") {
throw("features must be an array reference not a [".ref($features)."]");
}
my $strand = $features->[0]->strand;
throw ('FeaturePair needs to have strand == 1 or strand == -1') if(!$strand);
my @f;
if( $strand == 1 ) {
@f = sort {$a->start <=> $b->start} @$features;
} else {
@f = sort { $b->start <=> $a->start} @$features;
}
my $hstrand = $f[0]->hstrand;
my $slice = $f[0]->slice();
my $hslice = $f[0]->hslice();
my $name = $slice->name() if($slice);
my $hname = $f[0]->hseqname;
my $score = $f[0]->score;
my $percent = $f[0]->percent_id;
my $analysis = $f[0]->analysis;
my $pvalue = $f[0]->p_value();
my $external_db_id = $f[0]->external_db_id;
my $hcoverage = $f[0]->hcoverage;
my $group_id = $f[0]->group_id;
my $level_id = $f[0]->level_id;
my $seqname = $f[0]->seqname;
$strand ||= 1;
$hstrand ||= 1;
my $ori = $strand * $hstrand;
throw("No features in the array to parse") if(scalar(@f) == 0);
my $prev1; my $prev2;
my $string;
my $f1start;
my $f1end;
my $f2end;
my $f2start;
if ($strand == 1) {
$f1start = $f[0]->start;
$f1end = $f[-1]->end;
} else {
$f1start = $f[-1]->start;
$f1end = $f[0]->end;
}
if ($hstrand == 1) {
$f2start = $f[0]->hstart;
$f2end = $f[-1]->hend;
} else {
$f2start = $f[-1]->hstart;
$f2end = $f[0]->hend;
}
foreach my $f (@f) {
if (!$f->isa("Bio::EnsEMBL::FeaturePair")) {
throw("Array element [$f] is not a Bio::EnsEMBL::FeaturePair");
}
if( defined($f->hstrand()) && $f->hstrand() != $hstrand ) {
throw("Inconsistent hstrands in feature array");
}
if( defined($f->strand()) && ($f->strand != $strand)) {
throw("Inconsistent strands in feature array");
}
if ( defined($name) && $name ne $f->slice->name()) {
throw("Inconsistent names in feature array [$name - ".
$f->slice->name()."]");
}
if ( defined($hname) && $hname ne $f->hseqname) {
throw("Inconsistent hit names in feature array [$hname - ".
$f->hseqname . "]");
}
if ( defined($score) && $score ne $f->score) {
throw("Inconsisent scores in feature array [$score - " .
$f->score . "]");
}
if (defined($f->percent_id) && $percent ne $f->percent_id) {
throw("Inconsistent pids in feature array [$percent - " .
$f->percent_id . "]");
}
if(defined($pvalue) && $pvalue != $f->p_value()) {
throw("Inconsistant p_values in feature arraw [$pvalue " .
$f->p_value() . "]");
}
if($seqname && $seqname ne $f->seqname){
throw("Inconsistent seqname in feature array [$seqname - ".
$f->seqname . "]");
}
my $start1 = $f->start; my $start2 = $f->hstart();
if (defined($prev1)) {
if ( $strand == 1 ) {
if ($f->start < $prev1) {
throw("Inconsistent coords in feature array (forward strand).\n" .
"Start [".$f->start()."] in current feature should be greater " .
"than previous feature end [$prev1].");
}
} else {
if ($f->end > $prev1) {
throw("Inconsistent coords in feature array (reverse strand).\n" .
"End [".$f->end() ."] should be less than previous feature " .
"start [$prev1].");
}
}
}
my $length = ($f->end - $f->start + 1); my $hlength = ($f->hend - $f->hstart + 1);
if($query_unit > $hit_unit){
my $query_p_length = sprintf "%.0f", ($length/$query_unit); my $hit_p_length = sprintf "%.0f", ($hlength * $hit_unit);
if( $query_p_length != $hit_p_length) {
throw( "Feature lengths not comparable Lengths:" .$length .
" " . $hlength . " Ratios:" . $query_unit . " " .
$hit_unit );
}
} else{
my $query_d_length = sprintf "%.0f", ($length*$hit_unit);
my $hit_d_length = sprintf "%.0f", ($hlength * $query_unit);
if( $length * $hit_unit != $hlength * $query_unit ) {
throw( "Feature lengths not comparable Lengths:" . $length .
" " . $hlength . " Ratios:" . $query_unit . " " .
$hit_unit );
}
}
my $hlengthfactor = ($query_unit/$hit_unit);
my $insertion_flag = 0;
if( $strand == 1 ) {
if( ( defined $prev1 ) && ( $f->start > $prev1 + 1 )) {
$insertion_flag = 1;
my $gap = $f->start - $prev1 - 1;
if( $gap == 1 ) {
$gap = ""; }
$string .= "$gap"."I";
}
$prev1 = $f->end();
} else {
if(( defined $prev1 ) && ($f->end + 1 < $prev1 )) {
$insertion_flag = 1;
my $gap = $prev1 - $f->end() - 1;
if( $gap == 1 ) {
$gap = ""; }
$string .= "$gap"."I";
}
$prev1 = $f->start();
}
if( $hstrand == 1 ) {
if(( defined $prev2 ) && ( $f->hstart() > $prev2 + 1 )) {
my $gap = $f->hstart - $prev2 - 1;
my $gap2 = int( $gap * $hlengthfactor + 0.5 );
if( $gap2 == 1 ) {
$gap2 = ""; }
$string .= "$gap2"."D";
if($insertion_flag) {
if ($message_only_once) {
warning("Should not be an deletion and insertion on the " .
"same alignment region. cigar_line=$string\n");
$message_only_once = 0;
}
}
}
$prev2 = $f->hend();
} else {
if( ( defined $prev2 ) && ( $f->hend() + 1 < $prev2 )) {
my $gap = $prev2 - $f->hend - 1;
my $gap2 = int( $gap * $hlengthfactor + 0.5 );
if( $gap2 == 1 ) {
$gap2 = ""; }
$string .= "$gap2"."D";
if($insertion_flag) {
if ($message_only_once) {
warning("Should not be an deletion and insertion on the " .
"same alignment region. prev2 = $prev2; f->hend() = " .
$f->hend() . "; cigar_line = $string;\n");
$message_only_once = 0;
}
}
}
$prev2 = $f->hstart();
}
my $matchlength = $f->end() - $f->start() + 1;
if( $matchlength == 1 ) {
$matchlength = "";
}
$string .= $matchlength."M";
}
$self->{'start'} = $f1start;
$self->{'end'} = $f1end;
$self->{'seqname'} = $seqname;
$self->{'strand'} = $strand;
$self->{'score'} = $score;
$self->{'percent_id'} = $percent;
$self->{'analysis'} = $analysis;
$self->{'slice'} = $slice;
$self->{'hslice'} = $hslice;
$self->{'hstart'} = $f2start;
$self->{'hend'} = $f2end;
$self->{'hstrand'} = $hstrand;
$self->{'hseqname'} = $hname;
$self->{'cigar_string'} = $string;
$self->{'p_value'} = $pvalue;
$self->{'external_db_id'} = $external_db_id;
$self->{'hcoverage'} = $hcoverage;
$self->{'group_id'} = $group_id;
$self->{'level_id'} = $level_id;} |
sub _query_unit
{ my $self = shift;
throw( "Abstract method call!" );
}
1; } |
sub alignment_length
{ my $self = shift;
if (! defined $self->{'_alignment_length'} && defined $self->cigar_string) {
my @pieces = ( $self->cigar_string =~ /(\d*[MDI])/g );
unless (@pieces) {
print STDERR "Error parsing cigar_string\n";
}
my $alignment_length = 0;
foreach my $piece (@pieces) {
my ($length) = ( $piece =~ /^(\d*)/ );
if (! defined $length || $length eq "") {
$length = 1;
}
$alignment_length += $length;
}
$self->{'_alignment_length'} = $alignment_length;
}
return $self->{'_alignment_length'};} |
sub cigar_string
{ my $self = shift;
$self->{'cigar_string'} = shift if(@_);
return $self->{'cigar_string'};} |
sub new
{
my $caller = shift;
my $class = ref($caller) || $caller;
my $self = $class->SUPER::new(@_);
my ($cigar_string,$features) = rearrange([qw(CIGAR_STRING FEATURES)], @_);
if (defined($cigar_string) && defined($features)) {
throw("CIGAR_STRING or FEATURES argument is required - not both.");
} elsif (defined($features)) {
$self->_parse_features($features);
} elsif (defined($cigar_string)) {
$self->{'cigar_string'} = $cigar_string;
} else {
throw("CIGAR_STRING or FEATURES argument is required");
}
return $self;} |
sub new_fast
{ my ($class, $hashref) = @_;
return bless $hashref, $class; } |
sub reverse_complement
{ my ($self) = @_;
$self->strand($self->strand * -1);
$self->hstrand($self->hstrand * -1);
my $cigar_string = $self->cigar_string;
$cigar_string =~ s/(D|I|M)/$1 /g;
my @cigar_pieces = split / /,$cigar_string;
$cigar_string = "";
while (my $piece = pop @cigar_pieces) {
$cigar_string .= $piece;
}
$self->{'strands_reversed'} = 0 unless (defined $self->{'strands_reversed'});
if ($self->strands_reversed) {
$self->strands_reversed(0)
} else {
$self->strands_reversed(1);
}
$self->cigar_string($cigar_string); } |
sub strands_reversed
{ my ($self, $arg) = @_;
if ( defined $arg ) {
$self->{'strands_reversed'} = $arg ;
}
$self->{'strands_reversed'} = 0 unless (defined $self->{'strands_reversed'});
return $self->{'strands_reversed'};} |
sub transform
{ my $self = shift;
if( ref $_[0] eq 'HASH') {
deprecate("Calling transform with a hashref is deprecate.\n" .
'Use $feat->transfer($slice) or ' .
'$feat->transform("coordsysname") instead.');
my (undef, $new_feat) = each(%{$_[0]});
return $self->transfer($new_feat->slice);
}
my $new_feature = $self->SUPER::transform( @_ );
if( ! defined $new_feature or
$new_feature->length != $self->length) {
my @segments = $self->project( @_ );
return undef if( ! @segments );
my @ungapped;
foreach my $f ($self->ungapped_features) {
$f = $f->transform( @_ );
if (defined $f) {
push @ungapped, $f;
} else {
warning("Failed to transform alignment feature; " .
"ungapped component could not be transformed");
return undef;
}
}
eval {
$new_feature = $self->new(-features =>\@ ungapped );
};
if ($@) {
warning($@);
return undef;
}
}
return $new_feature; } |
sub ungapped_features
{ my ($self) = @_;
if (!defined($self->{'cigar_string'})) {
throw("No cigar_string defined. Can't return ungapped features");
}
return @{$self->_parse_cigar()};} |
General documentation
Copyright (c) 1999-2009 The European Bioinformatics Institute and
Genome Research Limited. All rights reserved.
This software is distributed under a modified Apache license.
For license details, please see
/info/about/code_licence.html